PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn210241
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 92aa    MW: 10729.7 Da    PI: 10.8276
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn210241genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.53.6e-293080252
     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52
                prlrWtpeLH++Fv+av++LGG+ kAtPk+il++m+v gL ++h+kSHLQ+
  Achn210241 30 PRLRWTPELHQHFVDAVQRLGGKYKATPKRILQMMDVSGLEISHIKSHLQR 80
                8*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.2112686IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-262780IPR009057Homeodomain-like
SuperFamilySSF466892.46E-142980IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-213080IPR006447Myb domain, plants
PfamPF002493.4E-93180IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MRCWAQPLNQ EMKMCERSGC VRRYKKSQVP RLRWTPELHQ HFVDAVQRLG GKYKATPKRI  60
LQMMDVSGLE ISHIKSHLQR SLELKLGRLE G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010657107.19e-30PREDICTED: uncharacterized protein LOC100855381
SwissprotQ700D97e-25MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A151U1Z64e-31A0A151U1Z6_CAJCA; Putative Myb family transcription factor At1g14600 family
STRINGVIT_12s0028g00980.t012e-30(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.14e-26G2-like family protein